DC Chemicals-Focus on Bioactive Chemicals

DC Chemicals

-Chemicals for Life Science

-competitive price and high quality!
www.dcchemicals.com

COA of STIEEQAKTFLDKFNHEAEDLFYQSSLASWN

Description:

STIEEQAKTFLDKFNHEAEDLFYQSSLASWN, an angiotensin-converting enzyme 2 (ACE2) related peptide, can be used to study the function of ACE2.

Chemical Information

Catalog Other Targets
Molecular Weight (MW) 3649.88
Molecular Formula C164H238N40O55
Storage 2 years -20°C Powder, 2 weeks 4°C in DMSO, 6 months -80°C in DMSO

Handling:

Providing storage is as stated on the product vial and the vial is kept tightly sealed, the product can be stored for up to 24 months.
Wherever possible, you should prepare and use solutions on the same day. However, if you need to make up stock solutions in advance, we recommend that you store the solution as aliquots in tightly sealed vials at -20°C. Generally, these will be useable for up to one month. Before use, and prior to opening the vial we recommend that you allow your product to equilibrate to room temperature for at least 1 hour.