Home > Inhibitors & Agonists > Metabolic Enzyme/Protease > Angiotensin-converting Enzyme (ACE)
Cat. No. Product name CAS No.
DC9152 Benazepril Hydrochloride

Benazepril hydrochloride, an angiotensin converting enzyme inhibitor, which is a medication used to treat high blood pressure.

86541-74-4
DC8975 Captopril

Captopril is a potent, competitive inhibitor of angiotensin-converting enzyme (ACE).

62571-86-2
DC9325 Cilazapril (monohydrate)

Cilazapril Monohydrate is a angiotensin-converting enzyme (ACE) inhibitor used for the treatment of hypertension and congestive heart failure.

92077-78-6
DC12262 H-Val-Pro-Pro-OH TFA

H-Val-Pro-Pro-OH (TFA), a milk-derived proline peptides derivative, is an inhibitor of Angiotensin I converting enzyme (ACE), with an IC50 of 9 μM.

DC9123 Lisinopril Dihydrate

Lisinopril Dihydrate is angiotensin-converting enzyme inhibitor, used in treatment of hypertension, congestive heart failure, and heart attacks.

83915-83-7
DC12255 MLN-4760 Featured

MLN-4760 is a potent and selective human ACE2 inhibitor (IC50, 0.44 nM), with excellent selectivity (>5000-fold) versus related enzymes including human testicular ACE (IC50, >100 μM) and bovine carboxypeptidase A (CPDA; IC50, 27 μM).

305335-31-3
DC9326 Moexipril (hydrochloride)

Moexipril HCl is a potent orally active non-sulfhydryl angiotensin converting enzyme(ACE) inhibitor, which is used for the treatment of hypertension and congestive heart failure.

82586-52-5
DC10324 Omapatrilat

Omapatrilat is a dual inhibitor of the metalloproteases ACE and NEP with Ki values of 0.64 and 0.45 nM, respectively.

167305-00-2
DC9128 Ramipril

Ramipril is an angiotensin-converting enzyme (ACE) inhibitor with IC50 of 5 nM.

87333-19-5
DC9327 Temocapril (hydrochloride)

Temocapril Hydrochloride is a long-acting angiotensin-converting enzyme (ACE) inhibitor, used for the treatment of hypertension.

110221-44-8
DC9328 Zofenopril (calcium)

Zofenopril Calcium(SQ26991) is an antioxidant that acts as an angiotensin-converting enzyme inhibitor.

81938-43-4
DC28192 Delapril hydrochloride

Delapril is an angiotensin-converting enzyme (ACE) inhibitor for the treatment of cardiovascular diseases.

83435-67-0
DC28193 Deserpidine

Deserpidine (Harmonyl) is an alkaloid isolated from the root of Rauwolfia canescens related to Reserpine. Deserpidine is used as an antihypertensive agent and a tranquilizer. Deserpidine is a competitive angiotensin converting enzyme (ACE) inhibitor. Deserpidine also decreases angiotensin II-induced aldosterone secretion by the adrenal cortex.

131-01-1
DC29151 DX600 TFA

DX600 TFA is an ACE2 specific inhibitor, and do not cross-react with ACE.

DC40003 BML-111

BML-111, a lipoxin A4 analog, is a lipoxin A4 receptor agonist. BML-111 represses the activity of angiotensin converting enzyme (ACE) and increases the activity of angiotensinconverting enzyme 2 (ACE2). BML-111 has antiangiogenic, antitumor and anti-inflammatory properties.

78606-80-1
DC40211 H-Ile-Pro-Pro-OH hydrochloride

H-Ile-Pro-Pro-OH hydrochloride, a milk-derived peptide, inhibits angiotensin-converting enzyme (ACE) with an IC50 of 5 μM. Antihypertensive tripeptides.

1208862-61-6
DC41405 Icariside D2

Icariside D2, isolated from Annona glabra fruit, inhibits angiotensin-converting enzyme. Icariside D2 shows significant cytotoxic activity on the HL-60 cell line with the IC50 value of 9.0 ± 1.0 μM. Icariside D2 induces apoptosis .

38954-02-8
DC42333 Vicenin-1

Vicenin 1 is a C-glycosylflavone isolated from the aerial parts of Desmodium styracifolium, has any effect on angiotensin-converting enzyme (ACE)(IC50=52.50 μM).

35927-38-9
DC42520 Spirapril hydrochloride

Spirapril (SCH 33844) hydrochloride is a potent angiotensin converting enzyme (ACE) inhibitor with antihypertensive activity. Spirapril competitively binds to ACE and prevents the conversion of angiotensin I to angiotensin II. Spirapril is an orally active prodrug of Spiraprilat and can be used for the research of hypertension, congestive heart failure.

94841-17-5
DC44802 NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ

NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ is an angiotensin-converting enzyme 2 (ACE2) related peptide that can be used as a tool for understanding ACE2 functions.

DC45309 (R)-MLN-4760

(R)-MLN-4760, the R-enantiomer of MLN-4760, is a potent and selective ACE2 inhibitor, with an IC50 of 0.44 nM for human ACE2. (R)-MLN-4760 shows more than 5000-fold selectivity for ACE2 over ACE (IC50>100 μM) and CPDA (IC50=27 μM).

305335-29-9
DC45313 (R)-MLN-4760

(R)-MLN-4760, the R-enantiomer of MLN-4760, is an ACE2 inhibitor, with an IC50 of 8.4 μM. (R)-MLN-4760 is the less active isomer.

305335-29-9
Page 1 / Total 2 FirstPrevNextLastGoto