Alternate TextTo enhance service speed and avoid tariff delays, we've opened a US warehouse. All US orders ship directly from our US facility.

CAP18 (rabbit)

  Cat. No.:  DC41970  
Chemical Structure
152742-15-9
For research use only. We do not sell to patients.
We match the best price and quality on market.
Email:order@dcchemicals.com  sales@dcchemicals.com
Tel:+86 21 58447131
We are official vendor of:
  • 20
  • 19
  • 18
  • 17
  • 16
  • 15
  • 14
  • 12
  • 11
  • 10
  • 9
  • 8
  • 13
  • 6
  • 5
  • 4
  • 3
  • 2
  • 1
More than 5000 active chemicals with high quality for research!
Field of application
CAP18 (rabbit) is a 37 amino acids antimicrobial peptide originally isolated from rabbit granulocytes. CAP18 (rabbit) has broad antimicrobial activity against both Gram-positive (IC50, 130-200 nM) and Gram-negative (IC50, 20-100 nM) bacteria. CAP18 (rabbit) has the potential for bacterial sepsis research.
Cas No.: 152742-15-9
Chemical Name: CAP18 (rabbit)
Synonyms: GLRKRLRKFRNKIKEKLKKIGQKIQGLLPKLAPRTDY
Formula: C202H356N64O47
M.Wt: 4433.47
Sotrage: Please store the product under the recommended conditions in the Certificate of Analysis.
Cat. No. Product name Field of application
DC47747 MDP1 acetate MDP1 acetate, a Melittin-derived peptide, alters the integrity of both Gram-positive and Gram-negative bacterial membranes and kills the bacteria via membrane damages. MDP1 acetate has a high-antibacterial activity against multidrug resistant (MDR) and reference strains of S. aureus, E. coli, and P. aeruginosa.
DC47746 MDP1 MDP1, a Melittin-derived peptide, alters the integrity of both Gram-positive and Gram-negative bacterial membranes and kills the bacteria via membrane damages. MDP1 has a high-antibacterial activity against multidrug resistant (MDR) and reference strains of S. aureus, E. coli, and P. aeruginosa.
DC47745 NBTIs-IN-4 NBTIs-IN-4 demonstrates potent antibacterial activity against diverse Gram-positive pathogens, inhibition of both DNA gyrase and topoisomerase IV, a low frequency of resistance.
DC47744 Antibacterial agent 62 Antibacterial agent 62 is a novel redox cycling antituberculosis chemotype with potent bactericidal activity against growing and nutrient-starved phenotypically drug-resistant nongrowing bacteria.
DC47743 Anti gram-positive/negative bacteria agent 1 Anti gram-positive/negative bacteria agent 1 is an antibiotic conjugate with an artificial MECAM-based siderophore.
DC47742 Antibacterial agent 63 Antibacterial agent 63, a conjugate of aztreonam to a siderophore mimetic, shows activity against gram-negative bacteria.
DC47741 LpxA-IN-1 LpxA-IN-1 is a novel UDP-N-acetylglucosamine acyltransferase (LpxA) inhibitor (IC50 2 nM) with activity against Pseudomonas aeruginosa (MIC 8 μg/mL).
DC47740 Urease-IN-1 Urease-IN-1 is an urease inhibitor with an IC50 value of 2.21 ± 0.45 µM.
DC47739 JPD447 JPD447, a MAC-0547630 derivative, is a novel class of UppS inhibitor to potentiate β-lactam antibiotics.
DC47738 (8′α,9′β-Dihydroxy)-3-farnesylindole (8'α,9'β-Dihydroxy)-3-farnesylindole shows strong inhibitory activity (EC50 9.8 μM) against B. subtilis.
X