To enhance service speed and avoid tariff delays, we've opened a US warehouse. All US orders ship directly from our US facility.
| Cat. No. | Product Name | Field of Application | Chemical Structure |
|---|---|---|---|
| DC44830 | UK-59811 hydrochloride |
UK-59811 hydrochloride, a Br-dihydropyridine derivative, is a potent bacterial homotetrameric model voltage-gated Ca2+ (CaV) channel CaVAb inhibitor with an IC50 of 194 nM.
More description
|
|
| DC44829 | 1,2,4-Trihydroxybenzene |
1,2,4-Trihydroxybenzene (Hydroxyhydroquinone), a by-product of coffee bean roasting, increases intracellular Ca2+ concentration in rat thymic lymphocytes.
More description
|
|
| DC44828 | (Rac)-MEM 1003 |
(Rac)-MEM 1003 is the racemate of MEM 1003. MEM 1003, a dihydropyridine compound, is a potent L-type Ca2+ channel antagonist and has the potential for Alzheimer’s disease research.
More description
|
|
| DC44826 | S65487 |
S65487 (VOB560) is a potent and selective Bcl-2 inhibitor. S65487 has poor affinity with MCL-1, BFL-1 and BCL-XL. S65487 has anticaner activities.
More description
|
|
| DC44825 | PUMA BH3 |
PUMA BH3 is a p53 upregulated modulator of apoptosis (PUMA) BH3 domain peptide, acts as a direct activator of Bak, with a Kd of 26 nM.
More description
|
|
| DC44824 | LpxH-IN-AZ1 |
LpxH-IN-AZ1, a sulfonyl piperazine compound, is a potent UDP-2,3-diacylglucosamine pyrophosphate hydrolase LpxH inhibitor. LpxH-IN-AZ1 is a potent inhibitor of Klebsiella pneumoniae LpxH with IC50 of 0.36 μM .
More description
|
|
| DC44823 | Thiomandelic acid |
Thiomandelic acid is a broad spectrum inhibitor of Zinc -lactamases.
More description
|
|
| DC44822 | Monocaprylin |
Monocaprylin (Glyceryl monocaprylate), a monoglyceride of caprylic acid, exhibits an excellent antibacterial activity. Monocaprylin inhibits a variety of foodborne pathogenic and spoilage microorganisms and has the potential for an alternative food preservative research.
More description
|
|
| DC44821 | BPH-1358 free base |
BPH-1358 free base (NSC50460 free base) is a potent human farnesyl diphosphate synthase (FPPS) and undecaprenyl diphosphate synthase (UPPS) inhibitor with IC50s of 1.8 μM and 110 nM, respectively, and is active against S. aureus in vitro (MIC ~250 ng/mL).
More description
|
|
| DC44820 | Carvacrol methyl ether |
Carvacrol methyl ether, a Carvacrol analog, can be isolated from plant volatile oil. Carvacrol methyl ether exhibits antibacterial activity.
More description
|
|
| DC44819 | 4'-Hydroxy-3'-methylacetophenone |
4'-Hydroxy-3'-methylacetophenone, a phenolic volatile compound, is isolated from Hawaiian green coffee beans (Coffea Arabica L.). 4'-Hydroxy-3'-methylacetophenone has potent antioxidant activities. 4'-Hydroxy-3'-methylacetophenone also can be used to synthesize heterocyclic compounds which have antimycobacterial activity.
More description
|
|
| DC44818 | 3-Pentanol |
3-Pentanol is an active organic compound produced by plants and is a component of emitted insect sex pheromones. 3-pentanol elicits plant immunity against microbial pathogens and an insect pest in crop plants.
More description
|
|
| DC44817 | 3,4,5-Trimethoxybenzaldehyde |
3,4,5-Trimethoxybenzaldehyde is an intermediate for the synthesis of various pharmaceuticals, especially for trimethoprim used to treat bacterial infections, including urinary tract pathogens infection.
More description
|
|
| DC44816 | 2-Methoxybenzaldehyde |
2-Methoxybenzaldehyde (o-Anisaldehyde), isolated from cinnamon essential oil (CEO), exists antibacterial and antifungal activity.
More description
|
|
| DC44815 | 1-Tetradecanol |
1-Tetradecanol, isolated from Myristica fragrans, is a straight-chain saturated fatty alcohol. 1-Tetradecanol possesses antibacterial and anti-inflammatory (periodontitis) activity.
More description
|
|
| DC44814 | 1-Naphthalenemethanol |
1-Naphthalenemethanol is a natural compound the root bark extracts of Annona senegalensis with antibacterial activity.
More description
|
|
| DC44813 | 1-Hydroxy-2-butanone |
1-Hydroxy-2-butanone is a natural compound isolated from Bomboo Juice with antitubercular activity.
More description
|
|
| DC44812 | 1-Heptadecanol |
1-Heptadecanol is a long-chain primary alcohol with antibacterial activity from Solena amplexicaulis leaves.
More description
|
|
| DC44811 | Questin |
Questin is an antibacterial agent isolated from marine Aspergillus flavipes. Questin exhibits antibacterial activity against V. harveyi, V. anguillarum, V. cholerae, and V. parahemolyticus with MIC values of 31.25 µg/mL, 62.5 µg/mL, 62.5 µg/mL, and 125 µg/mL.
More description
|
|
| DC44810 | Lalistat 1 |
Lalistat 1 is a potent, selective, and competitive inhibitor of lysosomal acid lipase (LAL) and against purified human LAL (phLAL) with an IC50 of 68 nM. Lalistat 1 is a inhibitor of immunoglobulin A1 protease (IgA1P) proteases for H. influenzae, has less effects on other serine hydrolases (trypsin or β-lactamase, etc.). Lalistat 1 can be used for the research of niemann-pick type C (NPC) disease.
More description
|
|
| DC44809 | AUTAC4 |
AUTAC4 is a mitochondria-targeting autophagy-targeting chimera (AUTAC). AUTAC4 downregulates cytosolic proteins and promots targeted mitochondrial turnover via mitophagy.
More description
|
|
| DC44808 | Olaparib D4 |
Olaparib D4 (AZD2281 D4) is the deuterium labeled Olaparib (AZD2281). Olaparib is a potent and orally active PARP inhibitor with IC50s of 5 and 1 nM for PARP1 and PARP2, respectively. Olaparib is an autophagy and mitophagy activator.
More description
|
|
| DC44807 | Clematichinenoside AR |
Clematichinenoside AR is a major active ingredient that could be extracted from the traditional Chinese herb Clematis chinensis and has potent pharmacological effects on various diseases, including atherosclerosis (AS).
More description
|
|
| DC44806 | Sodium Fluoride |
Sodium fluoride (NaF) induces apoptosis and autophagy via the endoplasmic reticulum (ER) stress pathway in MC3T3-E1 osteoblastic cells.
More description
|
|
| DC44805 | (+)-Nortrachelogenin |
(+)-Nortrachelogenin (Wikstromol), a pharmacologically ligand from from wikstroemia indica, possesses antileukemic activity.
More description
|
|
| DC44804 | Monascorubrin |
Monascorubrin is purified from the mycelium of Monascus purpureus. Monascorubrin has significant antibiotic activities against Bacillus subtilis and Candida pseudotropicalis.
More description
|
|
| DC44803 | Caprazamycin |
Caprazamycin is a liponucleoside antibiotic.
More description
|
|
| DC44802 | NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ |
NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ is an angiotensin-converting enzyme 2 (ACE2) related peptide that can be used as a tool for understanding ACE2 functions.
More description
|
|
| DC44801 | Novokinin TFA |
Novokinin TFA is a peptide agonist of the angiotensin AT2 receptor.
More description
|
|
| DC44800 | Angiotensin I/II (1-6) (TFA) |
Angiotensin I/II (1-6) TFA contains the amino acids 1-6 and is converted from Angiotensin I/II peptide. The precursor angiotensinogen is cleaved by renin to form angiotensin I. Angiotensin I ishydrolyzed by angiotensin-converting enzyme (ACE) to form the biologically active angiotensin II. Angiotensin II has been investigated for the treatment, basic science, and diagnostic of Hypertension, Renin Angiotensin System, and Idiopathic Membranous Nephropathy.
More description
|
|