Alternate TextTo enhance service speed and avoid tariff delays, we've opened a US warehouse. All US orders ship directly from our US facility.

Insulin glargine

  Cat. No.:  DC49413  
Chemical Structure
160337-95-1
For research use only. We do not sell to patients.
We match the best price and quality on market.
Email:order@dcchemicals.com  sales@dcchemicals.com
Tel:+86-021-58447131
We are official vendor of:
  • 20
  • 19
  • 18
  • 17
  • 16
  • 15
  • 14
  • 12
  • 11
  • 10
  • 9
  • 8
  • 13
  • 6
  • 5
  • 4
  • 3
  • 2
  • 1
More than 5000 active chemicals with high quality for research!
Field of application
Insulin glargine is a long-acting insulin analog. Insulin glargine can be used for the diabetes mellitus.
Cas No.: 160337-95-1
Chemical Name: Insulin glargine
Synonyms: A-chain: GIVEQCCTSICSLYQLENYCG;B-chain: FVNQHLCGSHLVEALYLVCGERGFFYTPKTRR (Disulfide bridge: CysA6-CysA11, CysA7-CysB7, CysA20-CysB19)
Formula: C267H404N72O78S6
M.Wt: 6062.89
Sotrage: 2 years -20°C Powder, 2 weeks 4°C in DMSO, 6 months -80°C in DMSO
Cat. No. Product name Field of application
DC72496 CMX-2043 CMX-2043 is a novel analogue of α-Lipoic Acid. CMX-2043 is effective in antioxidant effect, activation of insulin receptor kinase, soluble tyrosine kinase, and Akt phosphorylation. CMX-2043 shows protection against ischemia-reperfusion injury (IRI) in rat model.
DC77190 DDN DDN is a selective insulin receptor (Insulin Receptor) activator, an insulin sensitizer, and a glucose-lowering insulin mimetic with oral bioavailability. DDN can directly bind to the receptor kinase domain and induce Akt and ERK phosphorylation, and it can also enhance insulin's effect on glucose uptake. DDN significantly reduces blood glucose levels in wild-type and diabetic ob/ob and db/db mice.
DC71094 NT219 NT219 is a potent and dual inhibitor of insulin receptor substrates 1/2 (IRS1/2) and STAT3. IRS1/2 and STAT3 are major signaling junctions regulated by various oncogenes. NT219 affects IRS1/2 degradation and inhibits STAT3 phosphorylation. NT219 has the potential for the research of cancer diseases.
DC71030 Demethylasterriquinone B1 Demethylasterriquinone B1 is a selective insulin receptor activator. Demethylasterriquinone B1 stimulates tyrosine phosphorylation of the IR β subunit, and the activation of PIK3 and AKT.
DC50119 AVJ16 AVJ16 is a member of the insulin-like growth factor 2 mRNA-binding protein family. AVJ16 regulates protein translation by binding to the mRNAs of certain genes.
DC50118 HNMPA-(AM)3 HNMPA-(AM)3 is a cell-permeable and selective insulin receptor tyrosine kinase inhibitor analog of HNMPA. HNMPA-(AM)3 greatly inhibits the ability of prothoracicotropic hormone (PTTH) to activate ERK phosphorylation and stimulate ecdysteroidogenesis.
DC49413 Insulin glargine Insulin glargine is a long-acting insulin analog. Insulin glargine can be used for the diabetes mellitus.
DC48362 OI338 OI338 is an orally available, ultralong-acting insulin analogue.
DC47979 HNMPA HNMPA is a membrane impermeable insulin receptor tyrosine kinase inhibitor. HNMPA inhibits serine and tyrosine autophosphorylation by the human insulin receptor. HNMPA has no effect on protein kinase C or cyclic AMP-dependent protein kinase activities
X