Alternate TextTo enhance service speed and avoid tariff delays, we've opened a US warehouse. All US orders ship directly from our US facility.
Home > Products

Products

You can also try the following methods, and our professionals will serve you Customized Consultation
Cat. No. Product Name Field of Application Chemical Structure
DC45072 LL-37 scrambled peptide
LL-37 scrambled peptide is a scrambled version of cathelicidin anti-microbial peptide LL-37. LL-37 scrambled peptide can be used as a negative control of LL-37 peptide studies.
More description
DC45071 STIEEQAKTFLDKFNHEAEDLFYQSSLASWN
STIEEQAKTFLDKFNHEAEDLFYQSSLASWN, an angiotensin-converting enzyme 2 (ACE2) related peptide, can be used to study the function of ACE2.
More description
DC45070 NLS (PKKKRKV) (hydrochloride)
NLS (PKKKRKV) hydrochloride is a nuclear localization signal (NLS) derived from the simian virus 40 large tumor antigen (SV40 large T antigen). NLS (PKKKRKV) can function as a method to enhance nuclear entry in the field of gene transfer research.
More description
DC45069 DL-Penicillamine
DL-Penicillamine (DL-beta-Mercaptovaline, 3,3-Dimethyl-DL-cysteine, 3-Sulfanylvaline, Cuprimine, Depen, DL-PenA, DL-P) induces alteration of elastic fibers of periosteum-perichondrium and associates growth inhibition.
More description
DC45068 PBDB-T
PBDB-T is a wide bandgap polymer donor in Perylene diimide (PDI)-based polymer solar cells (PSCs).
More description
DC45067 HM-JF526 NHS
HM-JF526 NHS, a fuorogenic spontaneously blinking yellow-emitting dye, is a hydroxymethyl derivative of JF526. HM-JF526 NHS is suitable for super-resolution imaging including dSTORM, STED and single-molecule localization spectroscopy (SMLSM).
More description
DC45066 HaXS8
HaXS8 is a dimerizer that can promote a covalent and irreversible intracellular dimerization of HaloTag and SNAP-tagged proteins of interest. HaXS8 does not interfere with PI3K/mTOR signaling.
More description
DC45065 TP-472N
TP-472N is a negative control probe for TP-472. TP-472 is a potent and selective BRD7/9 probe.
More description
DC45064 Mifamurtide TFA
Mifamurtide TFA (MTP-PE TFA), an analog of the muramyl dipeptide (MDP), is a nonspecific immunomodulator by stimulating the immune response activating macrophages and monocytes. Mifamurtide TFA, an orphan drug, is a specific ligand of NOD2 used as an insulin sensitizer. Mifamurtide TFA has the potential for osteosarcoma research.
More description
DC45063 GPR35 agonist 2
GPR35 agonist 2 (compound 11) is a potent agonist of GPR35, with EC50s of 26 and 3.2 nM in the β-arrestin and Ca2+ release assay, respectively.
More description
DC45062 N-benzoyl-L-aspartic acid
N-benzoyl-L-aspartic acid, a major metabolite of benzyl glucosinolate, can be used for modification of peptides or proteins.
More description
DC45061 Nur77 modulator 1
Nur77 modulator 1 is a good Nur77 binder (KD = 3.58 μM). Nur77 modulator 1 up-regulates Nur77 expression, mediates sub-cellular localization of Nur77, induces Nur77-dependent ER stress and autophagy, and results in cell apoptosis. Anti-hepatoma activity.
More description
DC45060 SCH 32615
SCH 32615 is an enkephalinase (the enzymes responsible for the degradation of endogenous enkephalins) inhibitor. SCH 32615 can enhance surgery- and pregnancy-induced analgesia in mice.
More description
DC45059 MEISi-2
MEISi-2 is a selective inhibitor of MEIS, a key regulator of hematopoietic stem cell (HSC) self-renewal. MEISi-2 is developed for the research of cardiac injuries, hematopoiesis issues, bone marrow transplantations, and cancer.
More description
DC45058 Sephadex LH 20
Sephadex LH 20 could be used for the isolation of natural compounds and food, such as red wine and pigments.
More description
DC45057 JF635, SE
JF635, SE (JF635, NHS) is a red fluorogenic fluorescent dye containing an NHS ester that can be conjugated with primary amine groups. JF635, SE can be used in confocal fluorescent imaging, super-resolution microscopy, and live cell imaging.
More description
DC45056 Poly(2-hydroxyethyl methacrylate) (MW 20000)
Poly(2-hydroxyethyl methacrylate) (MW 20000) is one of the most important hydrogels in the biomaterials world. Poly(2-hydroxyethyl methacrylate) is the basic component of contact lenses, and is also used in implantation of soft tissues, synthetic transplant for gristle and bone, regeneration of neurotic tissue, transmission of drug and etc.
More description
DC45055 Poly(2-hydroxyethyl methacrylate) (MW 1000000)
Poly(2-hydroxyethyl methacrylate) (MW 1000000) is one of the most important hydrogels in the biomaterials world. Poly(2-hydroxyethyl methacrylate) is the basic component of contact lenses, and is also used in implantation of soft tissues, synthetic transplant for gristle and bone, regeneration of neurotic tissue, transmission of drug and etc.
More description
DC45054 N-(3-Methoxybenzyl-(9z,12z)-octadecadienamide
N-​(3-​Methoxybenzyl-​(9z,​12z)​-​octadecadienamide (Macamide impurity 10), the impurity of Macamide isolated from Lepidium meyenii.
More description
DC45053 24:0 Lyso PC
24:0 Lyso PC is a lysophospholipid (LyP). 24:0 Lyso PC could be used for mRNA drug delivery.
More description
DC45052 DMT-2′Fluoro-dU Phosphoramidite
DMT-2′Fluoro-dU Phosphoramidite could be used for nucleoside modification.
More description
DC45051 2'-OMe-Ac-C Phosphoramidite
2'-OMe-Ac-C Phosphoramidite is a modified phosphoramidite and can be used for the oligonucleotide synthesis.
More description
DC45050 Cimifugin 4'-O-β-D-glucopyranoside
Cimifugin 4'-O-β-D-glucopyranoside is a derivative of cimifugin.
More description
DC45049 Bz-rC Phosphoramidite
Bz-rC Phosphoramidite is a phosphinamide monomer that can be used in the preparation of oligonucleotides.
More description
DC45048 N-(3-Aminopropyl)cyclohexylamine
N-(3-Aminopropyl)cyclohexylamine, a cyclohexylamine derivative, acts as a selective and competitive inhibitor of spermidine synthase. N-(3-Aminopropyl)cyclohexylamine can be used for the research of neurological diseases.
More description
DC45047 L-Lactic acid-13C3
L-Lactic acid-13C3 is a stable isotope labeled L-Lactic acid analog. L-Lactic acid-13C3 can be used for lactate metabolism research.
More description
DC45046 DMT-dI
DMT-dI (5'-O-DMT-dI) is a deoxyuridine which can be used in the preparation of convertible nucleoside derivatives.
More description
DC45045 Cyclocreatine
Cyclocreatine is a Creatine analogue and acts as a potent bioenergetic protective agent by providing high levels of ATP. Cyclocreatine crosses membranes, enters the brain, and can be phosphorylated and dephosphorylated by creatine kinases.
More description
DC45044 Calcium lactate
Calcium lactate is used by the beverage industry as a source of calcium to fortify fruit juice. Calcium lactate facilitates the growth and phytic acid degradation of soybean sprouts.
More description
DC45043 5'-O-DMT-N2-ibu-dG
5'-O-DMT-N2-ibu-dG (N2-Isobutyryl-5′-O-(4,4′-dimethoxytrityl)-2′-deoxyguanosine) is a deoxynucleoside which can be used in the preparation of oligonucleotides.
More description

Customized Consultation X

Your information is safe with us. * Required Fields.

Your name
Company
Email
Procuct Name
Cat. No.
Remark
Verification code
Please fill out the characters in the picture
X