Parathyroid Hormone (1-34), bovine TFA|CAS 0|DC Chemicals

Cas No.:
Chemical Name:	Parathyroid Hormone (1-34), bovine TFA
Synonyms:	AVSEIQFMHNGKHLSSMERVEWLRKKLQDVHNF
Formula:	C₁₈₅H₂₈₉F₃N₅₄O₅₂S₂
M.Wt:	4222.79
Sotrage:	Please store the product under the recommended conditions in the Certificate of Analysis.

COA

MSDS

Cat. No.	Product name	Field of application
DC46974	Glutaurine	Glutaurine containing glutamine and taurine residues is an orally active hormone of the parathyroid. Glutaurine, as a hormone, is isolated from parathyroid gland oxyphil cells. Glutaurine can be used for the research of antiepileptic and anti-amnesia.
DC46381	SBC-115337	SBC-115337, as a potent benzofuran compound, is a PCSK9 inhibitor with an IC50 value of 0.5 μM.
DC45609	NH-3	NH-3 is an orally active, reversible thyroid hormone receptor (THR) antagonist with an IC50 of 55 nM. NH-3, a derivative of the selective thyromi-metic GC-1, inhibits binding of thyroid hormones to their receptor and that inhibits cofactor recruitment.
DC45355	1α-Hydroxy-3-epi-vitamin D3	1α-Hydroxy-3-epi-vitamin D3, a natural metabolite of 1alpha,25-dihydroxyvitamin D3, is a potent suppressor of parathyroid hormone (PTH) secretion.
DC45280	DPC-AJ1951	DPC-AJ1951, a 14 amino acid peptide that acts as a potent agonist of the parathyroid hormone (PTH)/PTH-related peptide receptor (PPR) , and characterized its activity in ex vivo and in vivo assays of bone resorption.
DC42012	Parathyroid Hormone (1-34), human, biotinylated	Parathyroid Hormone (1-34), human, biotinylated is a probe for the parathyroid hormone receptor, can be used for analyzing the interaction between parathyroid hormone and parathyroid hormone receptors in living cells and for purifying hormone-receptor complexes with affinity columns.
DC41963	(D-Trp12,Tyr34)-pTH (7-34) amide (bovine)	(D-Trp12,Tyr34)-pTH (7-34) amide (bovine) is a potent and competitive antagonist of parathyroid hormone (PTH), with a Ki of 69 nM in bovine renal cortical membrane. (D-Trp12,Tyr34)-pTH (7-34) amide (bovine) can be used for growth and development regulation.
DC41882	Parathyroid hormone (1-34) (rat)	Parathyroid hormone (1-34) (rat) is a parathyroid hormone (PTH) receptor agonist, increasing serum PTH levels and bone mass in rats.
DC41829	DPC-AJ1951 TFA	DPC-AJ1951 TFA, a 14 amino acid peptide that acts as a potent agonist of the parathyroid hormone (PTH)/PTH-related peptide receptor (PPR) , and characterized its activity in ex vivo and in vivo assays of bone resorption.
DC41693	Parathyroid Hormone (1-34), bovine TFA	Parathyroid Hormone (1-34), bovine TFA is a potent parathyroid hormone (PTH) receptor agonist. Parathyroid Hormone (1-34), bovine increases calcium and inorganic phosphate levels in vivo. Parathyroid Hormone (1-34), bovine can be used for th reseach of osteoporosis.