Alternate TextTo enhance service speed and avoid tariff delays, we've opened a US warehouse. All US orders ship directly from our US facility.

GIP (3-42), human

  Cat. No.:  DC42044  
Chemical Structure
1802086-25-4
For research use only. We do not sell to patients.
We match the best price and quality on market.
Email:order@dcchemicals.com  sales@dcchemicals.com
Tel:+86-021-58447131
We are official vendor of:
  • 20
  • 19
  • 18
  • 17
  • 16
  • 15
  • 14
  • 12
  • 11
  • 10
  • 9
  • 8
  • 13
  • 6
  • 5
  • 4
  • 3
  • 2
  • 1
More than 5000 active chemicals with high quality for research!
Field of application
GIP (3-42), human acts as a glucose-dependent insulinotropic polypeptide (GIP) receptor antagonist, moderating the insulin secreting and metabolic actions of GIP in vivo.
Cas No.: 1802086-25-4
Chemical Name: GIP (3-42), human
Synonyms: EGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
Formula: C214H324N58O63S
M.Wt: 4759.40
Sotrage: Please store the product under the recommended conditions in the Certificate of Analysis.
Cat. No. Product name Field of application
DC45692 DA-JC4 DA-JC4 is a dual GLP-1/GIP receptor agonist can be used for the research of neurological disease and insulin signaling pathways.
DC44221 GIP (1-30) amide, porcine TFA GIP (1-30) amide, porcine TFA is a full glucose-dependent insulinotropic polypeptide (GIP) receptor agonist with high affinity equal to native GIP(1-42). GIP (1-30) amide, porcine is a weak inhibitor of gastric acid secretion and potent stimulator of insulin.
DC44220 GIP, human TFA GIP, human TFA is thought to act as an inhibitor of gastric functions. GIP, human TFA, a peptide hormone consisting of 42 amino acids, is a weak inhibitor of gastric acid secretion and a potent stimulator of insulin post meals.
DC42044 GIP (3-42), human GIP (3-42), human acts as a glucose-dependent insulinotropic polypeptide (GIP) receptor antagonist, moderating the insulin secreting and metabolic actions of GIP in vivo.
DC42043 GIP (1-30) amide, porcine GIP (1-30) amide, porcine is a full glucose-dependent insulinotropic polypeptide (GIP) receptor agonist with high affinity equal to native GIP(1-42).
DC41861 S961 acetate S961 acetate is an high-affinity and selective insulin receptor (IR) antagonist with IC50s of 0.048, 0.027, and 630 nM for HIR-A, HIR-B, and human insulin-like growth factor I receptor (HIGF-IR) in SPA-assay, respectively.
X