GIP, human TFA|CAS |DC Chemicals

Cas No.:
Chemical Name:	GIP, human TFA
Synonyms:	YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
Formula:	C₂₂₈H₃₃₉F₃N₆₀O₆₈S
M.Wt:	5097.62
Sotrage:	2 years -20°C Powder, 2 weeks 4°C in DMSO, 6 months -80°C in DMSO

MSDS

COA

Cat. No.	Product name	Field of application
DC45692	DA-JC4	DA-JC4 is a dual GLP-1/GIP receptor agonist can be used for the research of neurological disease and insulin signaling pathways.
DC44221	GIP (1-30) amide, porcine TFA	GIP (1-30) amide, porcine TFA is a full glucose-dependent insulinotropic polypeptide (GIP) receptor agonist with high affinity equal to native GIP(1-42). GIP (1-30) amide, porcine is a weak inhibitor of gastric acid secretion and potent stimulator of insulin.
DC44220	GIP, human TFA	GIP, human TFA is thought to act as an inhibitor of gastric functions. GIP, human TFA, a peptide hormone consisting of 42 amino acids, is a weak inhibitor of gastric acid secretion and a potent stimulator of insulin post meals.
DC42044	GIP (3-42), human	GIP (3-42), human acts as a glucose-dependent insulinotropic polypeptide (GIP) receptor antagonist, moderating the insulin secreting and metabolic actions of GIP in vivo.
DC42043	GIP (1-30) amide, porcine	GIP (1-30) amide, porcine is a full glucose-dependent insulinotropic polypeptide (GIP) receptor agonist with high affinity equal to native GIP(1-42).
DC41861	S961 acetate	S961 acetate is an high-affinity and selective insulin receptor (IR) antagonist with IC50s of 0.048, 0.027, and 630 nM for HIR-A, HIR-B, and human insulin-like growth factor I receptor (HIGF-IR) in SPA-assay, respectively.