HIF-1 alpha (556-574) is a short hypoxia-inducible factor-1 (HIF-1) 19 residues fragment. HIF-1 functions as master regulator of response to oxygen homeostasis.

AGA-(C8R) HNG17, Humanin derivative is a potent humanin (HN) derivative. AGA-(C8R) HNG17, Humanin derivative completely suppresses neuronal cell death by Alzheimer's disease-relevant insults.

Abz-FR-K(Dnp)-P-OH is an angiotensin I-converting enzyme (ACE) substrate and an internally quenched fluorogenic substrate for real time fluorescent assay.

LL-37 scrambled peptide is a scrambled version of cathelicidin anti-microbial peptide LL-37. LL-37 scrambled peptide can be used as a negative control of LL-37 peptide studies.

STIEEQAKTFLDKFNHEAEDLFYQSSLASWN, an angiotensin-converting enzyme 2 (ACE2) related peptide, can be used to study the function of ACE2.

NLS (PKKKRKV) hydrochloride is a nuclear localization signal (NLS) derived from the simian virus 40 large tumor antigen (SV40 large T antigen). NLS (PKKKRKV) can function as a method to enhance nuclear entry in the field of gene transfer research.

DL-Penicillamine (DL-beta-Mercaptovaline, 3,3-Dimethyl-DL-cysteine, 3-Sulfanylvaline, Cuprimine, Depen, DL-PenA, DL-P) induces alteration of elastic fibers of periosteum-perichondrium and associates growth inhibition.

PBDB-T is a wide bandgap polymer donor in Perylene diimide (PDI)-based polymer solar cells (PSCs).

HM-JF526 NHS, a fuorogenic spontaneously blinking yellow-emitting dye, is a hydroxymethyl derivative of JF526. HM-JF526 NHS is suitable for super-resolution imaging including dSTORM, STED and single-molecule localization spectroscopy (SMLSM).

HaXS8 is a dimerizer that can promote a covalent and irreversible intracellular dimerization of HaloTag and SNAP-tagged proteins of interest. HaXS8 does not interfere with PI3K/mTOR signaling.

TP-472N is a negative control probe for TP-472. TP-472 is a potent and selective BRD7/9 probe.

Mifamurtide TFA (MTP-PE TFA), an analog of the muramyl dipeptide (MDP), is a nonspecific immunomodulator by stimulating the immune response activating macrophages and monocytes. Mifamurtide TFA, an orphan drug, is a specific ligand of NOD2 used as an insulin sensitizer. Mifamurtide TFA has the potential for osteosarcoma research.

GPR35 agonist 2 (compound 11) is a potent agonist of GPR35, with EC50s of 26 and 3.2 nM in the β-arrestin and Ca2+ release assay, respectively.

N-benzoyl-L-aspartic acid, a major metabolite of benzyl glucosinolate, can be used for modification of peptides or proteins.

Nur77 modulator 1 is a good Nur77 binder (KD = 3.58 μM). Nur77 modulator 1 up-regulates Nur77 expression, mediates sub-cellular localization of Nur77, induces Nur77-dependent ER stress and autophagy, and results in cell apoptosis. Anti-hepatoma activity.

SCH 32615 is an enkephalinase (the enzymes responsible for the degradation of endogenous enkephalins) inhibitor. SCH 32615 can enhance surgery- and pregnancy-induced analgesia in mice.

MEISi-2 is a selective inhibitor of MEIS, a key regulator of hematopoietic stem cell (HSC) self-renewal. MEISi-2 is developed for the research of cardiac injuries, hematopoiesis issues, bone marrow transplantations, and cancer.

Sephadex LH 20 could be used for the isolation of natural compounds and food, such as red wine and pigments.

JF635, SE (JF635, NHS) is a red fluorogenic fluorescent dye containing an NHS ester that can be conjugated with primary amine groups. JF635, SE can be used in confocal fluorescent imaging, super-resolution microscopy, and live cell imaging.

Poly(2-hydroxyethyl methacrylate) (MW 20000) is one of the most important hydrogels in the biomaterials world. Poly(2-hydroxyethyl methacrylate) is the basic component of contact lenses, and is also used in implantation of soft tissues, synthetic transplant for gristle and bone, regeneration of neurotic tissue, transmission of drug and etc.

Poly(2-hydroxyethyl methacrylate) (MW 1000000) is one of the most important hydrogels in the biomaterials world. Poly(2-hydroxyethyl methacrylate) is the basic component of contact lenses, and is also used in implantation of soft tissues, synthetic transplant for gristle and bone, regeneration of neurotic tissue, transmission of drug and etc.

N-​(3-​Methoxybenzyl-​(9z,​12z)​-​octadecadienamide (Macamide impurity 10), the impurity of Macamide isolated from Lepidium meyenii.

24:0 Lyso PC is a lysophospholipid (LyP). 24:0 Lyso PC could be used for mRNA drug delivery.

DMT-2′Fluoro-dU Phosphoramidite could be used for nucleoside modification.

2'-OMe-Ac-C Phosphoramidite is a modified phosphoramidite and can be used for the oligonucleotide synthesis.

Cimifugin 4'-O-β-D-glucopyranoside is a derivative of cimifugin.

Bz-rC Phosphoramidite is a phosphinamide monomer that can be used in the preparation of oligonucleotides.

N-(3-Aminopropyl)cyclohexylamine, a cyclohexylamine derivative, acts as a selective and competitive inhibitor of spermidine synthase. N-(3-Aminopropyl)cyclohexylamine can be used for the research of neurological diseases.

L-Lactic acid-13C3 is a stable isotope labeled L-Lactic acid analog. L-Lactic acid-13C3 can be used for lactate metabolism research.

DMT-dI (5'-O-DMT-dI) is a deoxyuridine which can be used in the preparation of convertible nucleoside derivatives.