To enhance service speed and avoid tariff delays, we've opened a US warehouse. All US orders ship directly from our US facility.
| Cat. No. | Product Name | Field of Application | Chemical Structure |
|---|---|---|---|
| DC45081 | BDC2.5 mimotope 1040-31 |
BDC2.5 mimotope 1040-31, a BDC2.5 TCR reactive peptide, is a strong agonistic peptide for diabetogenic T cell clone BDC2.5, and the 1040-31 peptide is specific for BDC 2.5 TCR Tg+ T cells.
More description
|
|
| DC45079 | Chemerin-9 (149-157) |
Chemerin-9 (149-157), the nonapeptide (149)YFPGQFAFS(157) (chemerin-9), corresponding to the C terminus of processed chemerin, retains most of the activity of the full-size protein, with regard to agonism toward the chemerinR.
More description
|
|
| DC45078 | TLQP-30 |
TLQP-30 is a VGF peptide.
More description
|
|
| DC45077 | NY-BR-1 p904 (A2) |
NY-BR-1 p904 (A2) is an HLA-A2-restricted NY-BR-1 epitope. T-cell clone specific for NY-BR-1 p904 can recognize breast tumor cells expressing NY-BR-1.
More description
|
|
| DC45076 | JAG-1, scrambled |
JAG-1, scrambled is a scrambled sequence of JAG-1. JAG-1, scrambled with a random sequence of the amino acids that are the same as the active fragment. JAG-1, scrambled usually used as a negative control.
More description
|
|
| DC45075 | HIF-1 alpha (556-574) |
HIF-1 alpha (556-574) is a short hypoxia-inducible factor-1 (HIF-1) 19 residues fragment. HIF-1 functions as master regulator of response to oxygen homeostasis.
More description
|
|
| DC45074 | AGA-(C8R) HNG17, humanin derivative |
AGA-(C8R) HNG17, Humanin derivative is a potent humanin (HN) derivative. AGA-(C8R) HNG17, Humanin derivative completely suppresses neuronal cell death by Alzheimer's disease-relevant insults.
More description
|
|
| DC45073 | Abz-FR-K(Dnp)-P-OH |
Abz-FR-K(Dnp)-P-OH is an angiotensin I-converting enzyme (ACE) substrate and an internally quenched fluorogenic substrate for real time fluorescent assay.
More description
|
|
| DC45072 | LL-37 scrambled peptide |
LL-37 scrambled peptide is a scrambled version of cathelicidin anti-microbial peptide LL-37. LL-37 scrambled peptide can be used as a negative control of LL-37 peptide studies.
More description
|
|
| DC45071 | STIEEQAKTFLDKFNHEAEDLFYQSSLASWN |
STIEEQAKTFLDKFNHEAEDLFYQSSLASWN, an angiotensin-converting enzyme 2 (ACE2) related peptide, can be used to study the function of ACE2.
More description
|
|
| DC45070 | NLS (PKKKRKV) (hydrochloride) |
NLS (PKKKRKV) hydrochloride is a nuclear localization signal (NLS) derived from the simian virus 40 large tumor antigen (SV40 large T antigen). NLS (PKKKRKV) can function as a method to enhance nuclear entry in the field of gene transfer research.
More description
|
|
| DC45069 | DL-Penicillamine |
DL-Penicillamine (DL-beta-Mercaptovaline, 3,3-Dimethyl-DL-cysteine, 3-Sulfanylvaline, Cuprimine, Depen, DL-PenA, DL-P) induces alteration of elastic fibers of periosteum-perichondrium and associates growth inhibition.
More description
|
|
| DC45068 | PBDB-T |
PBDB-T is a wide bandgap polymer donor in Perylene diimide (PDI)-based polymer solar cells (PSCs).
More description
|
|
| DC45067 | HM-JF526 NHS |
HM-JF526 NHS, a fuorogenic spontaneously blinking yellow-emitting dye, is a hydroxymethyl derivative of JF526. HM-JF526 NHS is suitable for super-resolution imaging including dSTORM, STED and single-molecule localization spectroscopy (SMLSM).
More description
|
|
| DC45066 | HaXS8 |
HaXS8 is a dimerizer that can promote a covalent and irreversible intracellular dimerization of HaloTag and SNAP-tagged proteins of interest. HaXS8 does not interfere with PI3K/mTOR signaling.
More description
|
|
| DC45065 | TP-472N |
TP-472N is a negative control probe for TP-472. TP-472 is a potent and selective BRD7/9 probe.
More description
|
|
| DC45064 | Mifamurtide TFA |
Mifamurtide TFA (MTP-PE TFA), an analog of the muramyl dipeptide (MDP), is a nonspecific immunomodulator by stimulating the immune response activating macrophages and monocytes. Mifamurtide TFA, an orphan drug, is a specific ligand of NOD2 used as an insulin sensitizer. Mifamurtide TFA has the potential for osteosarcoma research.
More description
|
|
| DC45063 | GPR35 agonist 2 |
GPR35 agonist 2 (compound 11) is a potent agonist of GPR35, with EC50s of 26 and 3.2 nM in the β-arrestin and Ca2+ release assay, respectively.
More description
|
|
| DC45062 | N-benzoyl-L-aspartic acid |
N-benzoyl-L-aspartic acid, a major metabolite of benzyl glucosinolate, can be used for modification of peptides or proteins.
More description
|
|
| DC45061 | Nur77 modulator 1 |
Nur77 modulator 1 is a good Nur77 binder (KD = 3.58 μM). Nur77 modulator 1 up-regulates Nur77 expression, mediates sub-cellular localization of Nur77, induces Nur77-dependent ER stress and autophagy, and results in cell apoptosis. Anti-hepatoma activity.
More description
|
|
| DC45060 | SCH 32615 |
SCH 32615 is an enkephalinase (the enzymes responsible for the degradation of endogenous enkephalins) inhibitor. SCH 32615 can enhance surgery- and pregnancy-induced analgesia in mice.
More description
|
|
| DC45059 | MEISi-2 |
MEISi-2 is a selective inhibitor of MEIS, a key regulator of hematopoietic stem cell (HSC) self-renewal. MEISi-2 is developed for the research of cardiac injuries, hematopoiesis issues, bone marrow transplantations, and cancer.
More description
|
|
| DC45058 | Sephadex LH 20 |
Sephadex LH 20 could be used for the isolation of natural compounds and food, such as red wine and pigments.
More description
|
|
| DC45057 | JF635, SE |
JF635, SE (JF635, NHS) is a red fluorogenic fluorescent dye containing an NHS ester that can be conjugated with primary amine groups. JF635, SE can be used in confocal fluorescent imaging, super-resolution microscopy, and live cell imaging.
More description
|
|
| DC45056 | Poly(2-hydroxyethyl methacrylate) (MW 20000) |
Poly(2-hydroxyethyl methacrylate) (MW 20000) is one of the most important hydrogels in the biomaterials world. Poly(2-hydroxyethyl methacrylate) is the basic component of contact lenses, and is also used in implantation of soft tissues, synthetic transplant for gristle and bone, regeneration of neurotic tissue, transmission of drug and etc.
More description
|
|
| DC45055 | Poly(2-hydroxyethyl methacrylate) (MW 1000000) |
Poly(2-hydroxyethyl methacrylate) (MW 1000000) is one of the most important hydrogels in the biomaterials world. Poly(2-hydroxyethyl methacrylate) is the basic component of contact lenses, and is also used in implantation of soft tissues, synthetic transplant for gristle and bone, regeneration of neurotic tissue, transmission of drug and etc.
More description
|
|
| DC45054 | N-(3-Methoxybenzyl-(9z,12z)-octadecadienamide |
N-(3-Methoxybenzyl-(9z,12z)-octadecadienamide (Macamide impurity 10), the impurity of Macamide isolated from Lepidium meyenii.
More description
|
|
| DC45053 | 24:0 Lyso PC |
24:0 Lyso PC is a lysophospholipid (LyP). 24:0 Lyso PC could be used for mRNA drug delivery.
More description
|
|
| DC45052 | DMT-2′Fluoro-dU Phosphoramidite |
DMT-2′Fluoro-dU Phosphoramidite could be used for nucleoside modification.
More description
|
|
| DC45051 | 2'-OMe-Ac-C Phosphoramidite |
2'-OMe-Ac-C Phosphoramidite is a modified phosphoramidite and can be used for the oligonucleotide synthesis.
More description
|
|